Dataset for protein Bmf of organism Hucho hucho

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W5N3A7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Hucho hucho GN=BMF (length=161 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALRNNMLPCGEPRPLFYGNAGFRLHFPARFEQVGDQGPHEQH
QGERGRMEWLQQQPQQPAHSMEVCIGQKLQLIGDQFHQEHLQLYHRNQRNMRPLWWRVASALLTLLFEQEAIAGGGRAGW
R
>gnl|bcl2dbpro|A0A4W5N721_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Hucho hucho GN=BMF (length=159 residues).
MDDEEDDVFEPDSHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLDQQPQLPARSIEVCIGQKLQLIGDQFHQEHLQVYHRNQRNMRPLWRRLASALLTLLFEQEAIAGGGRAGWR
© 1998-2020Legal notice