Dataset for protein Bmf of organism Hucho hucho

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W5N3A7_BMF-01      MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALRNNMLPCG--
A0A4W5N721_BMF-01      MDDEEDDVFEPD-SHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVA
                       ********* ** ***********************.*.* *******  

A0A4W5N3A7_BMF-01      -EPRPLFYGNAGFRLHFPARFEQVGDQGPHEQHQGERGRMEWLQQQPQQP
A0A4W5N721_BMF-01      QEPRPLFYGNAGFRLHFPAQFERVGDQGP----LGERGGMERLDQQPQLP
                        ******************.**.******     **** **.*:**** *

A0A4W5N3A7_BMF-01      AHSMEVCIGQKLQLIGDQFHQEHLQLYHRNQRNMRPLWWRVASALLTLLF
A0A4W5N721_BMF-01      ARSIEVCIGQKLQLIGDQFHQEHLQVYHRNQRNMRPLWRRLASALLTLLF
                       *.*:*********************:************.*:*********

A0A4W5N3A7_BMF-01      EQEAIAGGGRAGWR
A0A4W5N721_BMF-01      EQEAIAGGGRAGWR
                       **************

© 1998-2020Legal notice