Dataset for protein Bim of organism Hucho hucho

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A4W5NF23_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Hucho hucho GN=BCL2L11 (length=211 residues).
MNHNIGPNVSTTLIERRKSGESHPGGGAASRAEPSDNPQSCEGDQQSRGGIMIPNSLLGFQSRSPVFRTLYRSSSGYFSF
DSDSIPSSPLLKDNKSTQTPSPSSQVITHALQRLSRALETRRDYDVWPNPLRPYRARPPPTAGDMRPEILIGQELRRIGD
EFNNLFIHRRLAGRNGQVAQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
>gnl|bcl2dbpro|A0A4W5R3N6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Hucho hucho GN=BCL2L11 (length=215 residues).
MTDSSRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDIPQFSEGDQQSRGGIMMPNSLLGFQSRSPVFRTLSRSSSG
YFSFDSDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPQPTAGDMWPETLIGQELQ
RIGDEFNHLFIHGHLPGRNAQVAQANLQQMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A4W5R3N6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Hucho hucho GN=BCL2L11 (length=230 residues).
MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDIPQFSEGDQQSRGGIMMPNSLLGFQ
SRSPVFRTLSRSSSGYFSFDSDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPQPT
AGDMWPETLIGQELQRIGDEFNHLFIHGHLPGRNAQVAQANLQQMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A4W5R3N6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Hucho hucho GN=BCL2L11 (length=232 residues).
MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDIPQFSEGDQQSRGGIMMPNSLLGFQ
SRSPVFRTLSRSSSGYFSFDSDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPQPT
AGDMWPETLIGQELQRIGDEFNHLFIHGVSRYTTPALSLVYTHKGLEEPQISKDDDNAPYIQKMHHFGRVSI
© 1998-2020Legal notice