Dataset for protein Bim of organism Hucho hucho

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W5R3N6_BCL2L11      MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGELNPGGGAASG
A0A4W5R3N6_BCL2L11      MTLHRQNNKNSLTLILDLSYRQQNQSNGSTILIERGKYGELNPGGGAASG
A0A4W5NF23_BCL2L11      -------------------MNHNIGPNVSTTLIERRKSGESHPGGGAASR
A0A4W5R3N6_BCL2L11      ---------------MTDSSRQQNQSNGSTILIERGKYGELNPGGGAASG
                                            .::  .* ** **** * ** :******* 

A0A4W5R3N6_BCL2L11      AEPTDIPQFSEGDQQSRGGIMMPNSLLGFQSRSPVFRTLSRSSSGYFSFD
A0A4W5R3N6_BCL2L11      AEPTDIPQFSEGDQQSRGGIMMPNSLLGFQSRSPVFRTLSRSSSGYFSFD
A0A4W5NF23_BCL2L11      AEPSDNPQSCEGDQQSRGGIMIPNSLLGFQSRSPVFRTLYRSSSGYFSFD
A0A4W5R3N6_BCL2L11      AEPTDIPQFSEGDQQSRGGIMMPNSLLGFQSRSPVFRTLSRSSSGYFSFD
                        ***:* ** .***********:***************** **********

A0A4W5R3N6_BCL2L11      SDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRDYDAWPNPL
A0A4W5R3N6_BCL2L11      SDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRDYDAWPNPL
A0A4W5NF23_BCL2L11      SDSIPSSPLLKDNKSTQTPSPSSQVITHALQRLSRALETRRDYDVWPNPL
A0A4W5R3N6_BCL2L11      SDSIPSSPLLKDNKSTQTPSPSSQIMTHALQRMSQAQETNRDYDAWPNPL
                        ************************::******:*.* **.****.*****

A0A4W5R3N6_BCL2L11      HPYRPRPQPTAGDMWPETLIGQELQRIGDEFNHLFIHG---------HLP
A0A4W5R3N6_BCL2L11      HPYRPRPQPTAGDMWPETLIGQELQRIGDEFNHLFIHGVSRYTTPALSLV
A0A4W5NF23_BCL2L11      RPYRARPPPTAGDMRPEILIGQELRRIGDEFNNLFIHR---------RLA
A0A4W5R3N6_BCL2L11      HPYRPRPQPTAGDMWPETLIGQELQRIGDEFNHLFIHG---------HLP
                        .***.** ******.** ******.*******:****           * 

A0A4W5R3N6_BCL2L11      GRNAQVAQANLQQMHQEPAFLLWMGLLIGRLLQIILQRR
A0A4W5R3N6_BCL2L11      YTHKGLEEPQISKDDDNAPYIQKMHHF-GRVSI------
A0A4W5NF23_BCL2L11      GRNGQVAQGNLQQMHQEPAFLLWMGLLIGRLLQIILRRR
A0A4W5R3N6_BCL2L11      GRNAQVAQANLQQMHQEPAFLLWMGLLIGRLLQIILQRR
                          :  : : ::.:  ::..:: .*  : **:        

© 1998-2020Legal notice