Dataset for protein Bim of organism Gorilla gorilla gorilla

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
© 1998-2020Legal notice