Dataset for protein Bim of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2YQ13_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        **************************************************

A0A2I2YQ13_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2YQ13_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                        **************************************************

A0A2I2YQ13_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
A0A2I2YQ13_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----GIFE
                        *******************************      :. 

© 1998-2020Legal notice