Dataset for protein Bim of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2I2Y4B3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                        *****************************************         

A0A2I2Y4B3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2Y4B3_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2Y4B3_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2Y4B3_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2Y4B3_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2Y4B3_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
                                                                          

A0A2I2Y4B3_BCL2L11      -DRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAMASMRQAEPADMRPE
A0A2I2Y4B3_BCL2L11      TDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAMASMRQAEPADMRPE
A0A2I2Y4B3_BCL2L11      TDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAMASMRQAEPADMRPE
A0A2I2Y4B3_BCL2L11      TDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAMASMRQAEPADMRPE
A0A2I2Y4B3_BCL2L11      TDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAMVREIEEVVV-----
A0A2I2Y4B3_BCL2L11      TDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAMANWD----------
A0A2I2Y4B3_BCL2L11      TDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAMGIFE----------
A0A2I2Y4B3_BCL2L11      -ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST-----
A0A2I2Y4B3_BCL2L11      -DRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAMVVILEDIGDLSLWF
A0A2I2Y4B3_BCL2L11      -DRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAM----DDSAGSSLRI
                              . ..*       :*      : ** * :                

A0A2I2Y4B3_BCL2L11      IWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVW
A0A2I2Y4B3_BCL2L11      IWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVW
A0A2I2Y4B3_BCL2L11      IWIAQELRRIGDEFNAYYARRLEK--------------------------
A0A2I2Y4B3_BCL2L11      IWIAQELRRIGDEFNAYYARRMPLPPD-----------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      GFIFTGLDLYGHHHSQDTEQLNHKDFS-----------------------
A0A2I2Y4B3_BCL2L11      AL--------------------HREVQWPLEWLAKSS-------------
                                                                          

A0A2I2Y4B3_BCL2L11      RMH
A0A2I2Y4B3_BCL2L11      RMH
A0A2I2Y4B3_BCL2L11      ---
A0A2I2Y4B3_BCL2L11      ---
A0A2I2Y4B3_BCL2L11      ---
A0A2I2Y4B3_BCL2L11      ---
A0A2I2Y4B3_BCL2L11      ---
A0A2I2Y4B3_BCL2L11      ---
A0A2I2Y4B3_BCL2L11      ---
A0A2I2Y4B3_BCL2L11      ---
                           

© 1998-2023Legal notice