Dataset for protein Bim of organism Ficedula albicollis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A803VLS8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ficedula albicollis GN=BCL2L11 (length=52 residues).
MFHKAAVPEVQPEVWIAQELRRIGDEFNASYCPRRVTRTFPSALPTPLRGKG
>gnl|bcl2dbpro|A0A803WCD8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ficedula albicollis GN=BCL2L11 (length=110 residues).
RSRGPGRVGSGRVRHGRRALPAERSPAPALGCDKATQTPSPPCQALSHCLSAMGKLRGGSPSSSSSSSSSSPGSASWLPL
LTWRGFPQSPAKRGSSGGCGGEAPGETCKG
© 1998-2022Legal notice