Dataset for protein Bim of organism Ficedula albicollis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A803VLS8_BCL2L11      ------------------------------MFHKAAVPEVQPEVWIAQEL
A0A803WCD8_BCL2L11      RSRGPGRVGSGRVRHGRRALPAERSPAPALGCDKATQTPSPPCQALSHCL
                                                         **: .   *   ::: *

A0A803VLS8_BCL2L11      RRIGD----------------EFNASYCPRRVTRTFPSALPTPLRGKG--
A0A803WCD8_BCL2L11      SAMGKLRGGSPSSSSSSSSSSPGSASWLPLLTWRGFPQSPAKRGSSGGCG
                          :*.                  .**: *  . * **.: ..   . *  

A0A803VLS8_BCL2L11      ----------
A0A803WCD8_BCL2L11      GEAPGETCKG
                                  

© 1998-2022Legal notice