Dataset for protein classical BH3-containing proteins of organism Falco tinnunculus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C4TR55_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Falco tinnunculus GN=BCL2L11 (length=134 residues).
RRRRRRARGRRRGRAAAHTAAAPRPPRSAPGYFSFDAERSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQSHLLAEDV
QPEIWIAQELRRIGDEFNASYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ
>gnl|bcl2dbpro|A0A8C4TR55_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Falco tinnunculus GN=BCL2L11 (length=185 residues).
MAKQPPEVKAQRDGEGGRLPAAEGPGPAAQLRPGAPAALPGSAAAAGPPPRGPPASPGPFATRSPLFIFVRRSPLLSRSS
SGYFSFDAERSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQSHLLAEDVQPEIWIAQELRRIGDEFNASYCPRRGFLD
NQAGNPQIIILRLLRYIIRLIWRMQ
>gnl|bcl2dbpro|A0A8C4TR55_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Falco tinnunculus GN=BCL2L11 (length=141 residues).
MAKQPPEVKAQRDGEGGRLPAAEGPGPAAQLRPGAPAALPGSAAARSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQS
HLLAEDVQPEIWIAQELRRIGDEFNASYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ
>gnl|bcl2dbpro|A0A8C4V2J0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Falco tinnunculus GN=PMAIP1 (length=51 residues).
MPGRTVRKAAPPAAARAAVAQCALELRRIGDKWDLRQKILNLLMKLFCPET
>gnl|bcl2dbpro|A0A8C4XVG9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Falco tinnunculus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
© 1998-2023Legal notice