Dataset for protein classical BH3-containing proteins of organism Falco tinnunculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4V2J0_PMAIP1-      --------------------------------------------------
A0A8C4XVG9_BMF-01       -MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYS
A0A8C4TR55_BCL2L11      --------RRRRRRARG-----------RRRGRAAAHTAA----------
A0A8C4TR55_BCL2L11      MAKQPPEVKAQRDGEGG-----------RLPAAEGPGPAA----------
A0A8C4TR55_BCL2L11      MAKQPPEVKAQRDGEGG-----------RLPAAEGPGPAA----------
                                                                          

A0A8C4V2J0_PMAIP1-      ---------------MPG--------------------------------
A0A8C4XVG9_BMF-01       CLLGRFQLFPLTHCCGPG--------------------------------
A0A8C4TR55_BCL2L11      ------APRP--PRSAPG--------------------------------
A0A8C4TR55_BCL2L11      ------QLRPGAPAALPGSAAAAGPPPRGPPASPGPFATRSPLFIFVRRS
A0A8C4TR55_BCL2L11      ------QLRPGAPAALPGSAAA----------------------------
                                        **                                

A0A8C4V2J0_PMAIP1-      -------------------------RTVRKAAPPAAARAAVAQC------
A0A8C4XVG9_BMF-01       -----------------IRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C4TR55_BCL2L11      ---------YFSFDAERSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQ
A0A8C4TR55_BCL2L11      PLLSRSSSGYFSFDAERSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQ
A0A8C4TR55_BCL2L11      ----------------RSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQ
                                                 .:... :*.. :      .      

A0A8C4V2J0_PMAIP1-      ------------------------------------------ALELRRIG
A0A8C4XVG9_BMF-01       RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C4TR55_BCL2L11      SHLL----------------------------AEDVQPEIWIAQELRRIG
A0A8C4TR55_BCL2L11      SHLL----------------------------AEDVQPEIWIAQELRRIG
A0A8C4TR55_BCL2L11      SHLL----------------------------AEDVQPEIWIAQELRRIG
                                                                  * :*. *.

A0A8C4V2J0_PMAIP1-      DKWD-------------------LRQKILNLLMKLFCPET---------
A0A8C4XVG9_BMF-01       DQFH------RLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
A0A8C4TR55_BCL2L11      DEFNASYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ---------
A0A8C4TR55_BCL2L11      DEFNASYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ---------
A0A8C4TR55_BCL2L11      DEFNASYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ---------
                        *::                    :  .::  : .*              

© 1998-2023Legal notice