Dataset for protein Bim of organism Falco tinnunculus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C4TR55_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Falco tinnunculus GN=BCL2L11 (length=134 residues).
RRRRRRARGRRRGRAAAHTAAAPRPPRSAPGYFSFDAERSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQSHLLAEDV
QPEIWIAQELRRIGDEFNASYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ
>gnl|bcl2dbpro|A0A8C4TR55_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Falco tinnunculus GN=BCL2L11 (length=185 residues).
MAKQPPEVKAQRDGEGGRLPAAEGPGPAAQLRPGAPAALPGSAAAAGPPPRGPPASPGPFATRSPLFIFVRRSPLLSRSS
SGYFSFDAERSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQSHLLAEDVQPEIWIAQELRRIGDEFNASYCPRRGFLD
NQAGNPQIIILRLLRYIIRLIWRMQ
>gnl|bcl2dbpro|A0A8C4TR55_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Falco tinnunculus GN=BCL2L11 (length=141 residues).
MAKQPPEVKAQRDGEGGRLPAAEGPGPAAQLRPGAPAALPGSAAARSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQS
HLLAEDVQPEIWIAQELRRIGDEFNASYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ
© 1998-2023Legal notice