Dataset for protein Bim of organism Falco tinnunculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4TR55_BCL2L11      --------RRRRRRARGRRRGRAAAHTAAAPRP--PRSAPG---------
A0A8C4TR55_BCL2L11      MAKQPPEVKAQRDGEGGRLPAAEGPGPAAQLRPGAPAALPGSAAAAGPPP
A0A8C4TR55_BCL2L11      MAKQPPEVKAQRDGEGGRLPAAEGPGPAAQLRPGAPAALPGSAAA-----
                                . .*    **  .  .. .**  **  * : **         

A0A8C4TR55_BCL2L11      --------------------------------YFSFDAERSPAPLSCDKA
A0A8C4TR55_BCL2L11      RGPPASPGPFATRSPLFIFVRRSPLLSRSSSGYFSFDAERSPAPLSCDKA
A0A8C4TR55_BCL2L11      ---------------------------------------RSPAPLSCDKA
                                                               ***********

A0A8C4TR55_BCL2L11      TQTPSPPCQALSHCLSAMASRWQSHLLAEDVQPEIWIAQELRRIGDEFNA
A0A8C4TR55_BCL2L11      TQTPSPPCQALSHCLSAMASRWQSHLLAEDVQPEIWIAQELRRIGDEFNA
A0A8C4TR55_BCL2L11      TQTPSPPCQALSHCLSAMASRWQSHLLAEDVQPEIWIAQELRRIGDEFNA
                        **************************************************

A0A8C4TR55_BCL2L11      SYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ
A0A8C4TR55_BCL2L11      SYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ
A0A8C4TR55_BCL2L11      SYCPRRGFLDNQAGNPQIIILRLLRYIIRLIWRMQ
                        ***********************************

© 1998-2023Legal notice