Dataset for protein Bad of organism Esox lucius

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3P8Y761_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Esox lucius GN=BAD (length=191 residues).
MGCSTPYRNGISTSTILPHTTGTGDRLLPYGLFCLITIGTRDGTGAYGLFWLRNTHIHPLILCSFFIGEGRIRLNSESQV
FATSGGERSGELQGLGQGLNCVATEGLPFRVRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGQMKRVKSAGAAKQMTT
SPSWWAFLFSHKETETEKTPNLIITEPRSSE
>gnl|bcl2dbpro|A0A3P8Y761_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Esox lucius GN=BAD (length=166 residues).
MENIFTISDTESESSDVEETKKEWIAGQGKTGSRLGLSLNLPGEGRIRLNSESQVFATSGGERSGELQGLGQGLNCVATE
GLPFRVRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGQMKRVKSAGAAKQMTTSPSWWAFLFSHKETETEKTPNLIIT
EPRSSE
>gnl|bcl2dbpro|A0A3P8YI30_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Esox lucius GN=BAD (length=192 residues).
MFYSFCHSPCDECFLTICNAFGQCLLRMDVFSLQAFKMDHTQDCVGDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSN
RTLPGVRVRLYSESQVCSQVGRQDNTEFQVAMTPTEESGGDAAPFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKG
EPKRGIIPGRAKQVYRGWFSFLWSPKEAEGRD
>gnl|bcl2dbpro|A0A3P8YI30_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Esox lucius GN=BAD (length=159 residues).
MAFKMDHTQDCVGDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSNRTLPGVRVRLYSESQVCSQVGRQDNTEFQVAMT
PTEESGGDAAPFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGIIPGRAKQVYRGWFSFLWSPKEAEGRD
© 1998-2022Legal notice