Dataset for protein Bad of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8Y761_BAD-01      ------------------------------------MENIFTISDTESES
A0A3P8YI30_BAD-02      --------------------------------------MAFKMDHTQDCV
A0A3P8Y761_BAD-02      ---MGCSTPYRNGISTSTILPHTTGTGDRLLPYGLFCLITIG---TRDGT
A0A3P8YI30_BAD-01      MFYSFCHSP-----CDECFLTICNAFGQCLLRMDVFSLQAFKMDHTQDCV
                                                               :    * .  

A0A3P8Y761_BAD-01      SDVEETKKE----------------WIAGQGKTGSRLGLSLNLPGEGRIR
A0A3P8YI30_BAD-02      GDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSNR-----TLPGV-RVR
A0A3P8Y761_BAD-02      GA--------YGLFWLRNTHIHPLILCSFFIGEG-------------RIR
A0A3P8YI30_BAD-01      GDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSNR-----TLPGV-RVR
                       .                                .             *:*

A0A3P8Y761_BAD-01      LNSESQVFATSGGERSGELQGLGQGLNCVATEGLPFRVRSQSAPPALWAA
A0A3P8YI30_BAD-02      LYSESQVCSQVGRQDNTEFQVAMTPTEESGGDAAPFRGRSQSAPPALWAA
A0A3P8Y761_BAD-02      LNSESQVFATSGGERSGELQGLGQGLNCVATEGLPFRVRSQSAPPALWAA
A0A3P8YI30_BAD-01      LYSESQVCSQVGRQDNTEFQVAMTPTEESGGDAAPFRGRSQSAPPALWAA
                       * ***** :  * : . *:*      :  . :. *** ************

A0A3P8Y761_BAD-01      KRYGRQLRRMSDEFDTWLDKGQMKRVKSAGAAKQMTTSPSWWAFLFSHKE
A0A3P8YI30_BAD-02      KKYGCQLRRMSDEFDTWLDKGEPKRGIIPGRAKQV--YRGWFSFLWSPKE
A0A3P8Y761_BAD-02      KRYGRQLRRMSDEFDTWLDKGQMKRVKSAGAAKQMTTSPSWWAFLFSHKE
A0A3P8YI30_BAD-01      KKYGCQLRRMSDEFDTWLDKGEPKRGIIPGRAKQV--YRGWFSFLWSPKE
                       *.** ****************: **   .* ***:    .*::**:* **

A0A3P8Y761_BAD-01      TETEKTPNLIITEPRSSE
A0A3P8YI30_BAD-02      AEGRD-------------
A0A3P8Y761_BAD-02      TETEKTPNLIITEPRSSE
A0A3P8YI30_BAD-01      AEGRD-------------
                       :*  .             

© 1998-2022Legal notice