Dataset for protein Puma of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2GWE8_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=131 residues).
VRVSAGAARACLCQAPGASFSPWVPQQTRGPQPSLLPAEQHLESPVPSAPGALEGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRAAPEMEPN
>gnl|bcl2dbpro|A0A3Q2GWE8_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=261 residues).
VRVSAGAARACLCQAPGASFSPWVPQQTRGPRERHGPSTPGGQLPGAGRGPGPRRPAPLPAQPPGALGRVLRPLRARPAR
RARRARPAARCLPLRPRRPARRHRRPGGPPLAWGPPQPSPSPAPRRSTALTLAGRAAPGVAGAQRPGGPGGRPHPGSPGS
PGGGGAVGPGDRGPAAADGGRPERAVRAAETRGAAATPPLALEGPVQSHHGTPAPTQGPSGPGDGAQLGACTRPGDVGDL
GGRTLPPPDALASAGGSFCTM
© 1998-2020Legal notice