Dataset for protein Puma of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2GWE8_BBC3-02      VRVSAGAARACLCQAPGASFSPWVPQQTRGPQPSLLPAEQHLESPVPSAP
A0A3Q2GWE8_BBC3-01      VRVSAGAARACLCQAPGASFSPWVPQQTRGPRERHGPS-----TPGGQLP
                        *******************************.    *:     :*  . *

A0A3Q2GWE8_BBC3-02      GALEG-GPTQAAPGVRGEEEQWAREI-------GAQLRRMADDLNALYER
A0A3Q2GWE8_BBC3-01      GAGRGPGPRRPAPLPAQPPGALGRVLRPLRARPARRARRARPAARCLPLR
                        **  * ** ..**         .* :       . . **     ..*  *

A0A3Q2GWE8_BBC3-02      RRQEEQQRHRPSPWRVLYN-------------------------------
A0A3Q2GWE8_BBC3-01      PRRPARRHRRPGGPPLAWGPPQPSPSPAPRRSTALTLAGRAAPGVAGAQR
                         *.  ....**.   : :.                               

A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A3Q2GWE8_BBC3-01      PGGPGGRPHPGSPGSPGGGGAVGPGDRGPAAADGGRPERAVRAAETRGAA
                                                                          

A0A3Q2GWE8_BBC3-02      -----LIMGLLPLPRGRAAPEMEPN-------------------------
A0A3Q2GWE8_BBC3-01      ATPPLALEGPVQSHHGTPAPTQGPSGPGDGAQLGACTRPGDVGDLGGRTL
                              : * :   .* .**   *.                         

A0A3Q2GWE8_BBC3-02      ----------------
A0A3Q2GWE8_BBC3-01      PPPDALASAGGSFCTM
                                        

© 1998-2020Legal notice