Dataset for protein Bad of organism Electrophorus electricus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W4DXF5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Electrophorus electricus GN=BAD (length=209 residues).
MHNQYLLRLRKANFTREDYKKVIKAKTLREEGETPSNTSCWNPFRVTAFTMEKAPCGQRDDISALDDQDESRWSETIESD
DSPRISNHHIMPNNTATEVGGRVRLYSESQAYTVSHWEDTESQDGVSAEEGGGACEGAPFRGRSQSAPAALWKAKKYGRQ
LRRMSDEFDTWLDKGEIRRVSSPGKLSQKQTNQGWFSFLWCSKEEEGRK
>gnl|bcl2dbpro|A0A4W4HE29_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Electrophorus electricus GN=BAD (length=205 residues).
MFNSSFDFDRLRKVCAARHREQQPPADQTSRSVSVSYREFTSAAGQLSEVVFTMAQMFTISDTESDTSEGPGDTDQQGDS
KEAEPSQSEQHLHVPNTLRGEWTARQRNHSMNEAELQDSGAESFRRRSRSAPPILWAAKKYGRQLRKMSDEFDTLLDKGM
KRARSAGAARQMHTSPSWFAFLWSHKESDTETSSSVTAPDTRPAE
© 1998-2020Legal notice