Dataset for protein Bad of organism Electrophorus electricus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W4DXF5_BAD-01      MHNQYLLRLRKANFTREDYKKVIKAKTLREEGETPSNTSCWNPFRVT---
A0A4W4HE29_BAD-01      MFNSSF-----------DFDRLRKVCAARHREQQPPADQTSRSVSVSYRE
                       *.*. :           *:..: *. : *   : *.  .  ... *:   

A0A4W4DXF5_BAD-01      -----------------AFTMEKAPCGQRDDISALDDQDESRWSETIESD
A0A4W4HE29_BAD-01      FTSAAGQLSEVVFTMAQMFTISDTESDTSEGPGDTDQQGDSKEAEPSQSE
                                         **:..: ..  :. .  *:*.:*. :*. :*:

A0A4W4DXF5_BAD-01      DSPRISNHHIMPNNTATEVGGRVRLYSESQAYTVSHWEDTESQDGVSAEE
A0A4W4HE29_BAD-01      Q------HLHVPNTLRGEWTARQRNHSMNEA---------------ELQD
                       :      *  :**.   *  .* * :* .:*               . ::

A0A4W4DXF5_BAD-01      GGGACEGAPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEIRRV
A0A4W4HE29_BAD-01      SGAES----FRRRSRSAPPILWAAKKYGRQLRKMSDEFDTLLDKG-MKRA
                       .*. .    ** **.***. ** *********.******* **** :.*.

A0A4W4DXF5_BAD-01      SSPGKLSQKQTNQGWFSFLWCSKEEEGRK-------------
A0A4W4HE29_BAD-01      RSAGAARQMHTSPSWFAFLWSHKESDTETSSSVTAPDTRPAE
                        *.*   * :*. .**:***. **.:  .             

© 1998-2020Legal notice