Dataset for protein classical BH3-containing proteins of organism Echeneis naucrates

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A665TUH3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Echeneis naucrates GN=BAD (length=162 residues).
MSAQFTISDSESDPSEEVEEGDMSQSLEQEVFQRHNLTLPEIRTAGAGRTRLNSESHTSTGSRDEDFLARGDDEAGTPTD
GAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMRKVKSVGSAKQMHHSKSWWNYLFSHQETEGENNHLESHR
NE
>gnl|bcl2dbpro|A0A665VG08_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Echeneis naucrates GN=BMF (length=163 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEHRGTQTPGPALGPNNGMLPCGIAKEPRPLFYGNAGFRLHFPAQFELAGDQEVRG
QGSEEEQNGMEQLPRQQPVARSIEVCIGQKLQLIGDQFHREHLQLYHQNQRNQGPLWWRLATALLSLLFDRGLIAGGGGA
GRR
© 1998-2020Legal notice