Dataset for protein classical BH3-containing proteins of organism Echeneis naucrates

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A665TUH3_BAD-01      MSAQFTISDSESDPSEEVEEGDMSQSLEQEVFQRH----NLTLPEIRTAG
A0A665VG08_BMF-01      -----------------------MDDEEDDVFEPDPHFWRTTFREIKCEH
                                               :. *::**:      . *: **.   

A0A665TUH3_BAD-01      AGRTRLNSESHTSTG------------------------------SRDED
A0A665VG08_BMF-01      RGTQTPGPALGPNNGMLPCGIAKEPRPLFYGNAGFRLHFPAQFELAGDQE
                        *    ..   ...*                              : *::

A0A665TUH3_BAD-01      FLARGDDEAGTPTDGAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLL
A0A665VG08_BMF-01      VRGQGSEEEQNGMEQLP-----RQQPVARSIEVCIGQKLQLIGDQFH---
                       . ..*.:*  .  :  *     .. * *       ****. :.*:*    

A0A665TUH3_BAD-01      DKGEMRKVKSVGSAKQMHHSKSWW-------NYLFSHQETEGENNHLESH
A0A665VG08_BMF-01      -----REHLQLYHQNQRNQGPLWWRLATALLSLLFDRGLIAGGGGAGRR-
                            *:  .:   :* ::.  **       . **..    * ..     

A0A665TUH3_BAD-01      RNE
A0A665VG08_BMF-01      ---
                          

© 1998-2020Legal notice