Dataset for protein Bmf of organism Dromaius novaehollandiae

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C4J3Z9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Dromaius novaehollandiae GN=BMF (length=193 residues).
MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSQSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHVQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQR
>gnl|bcl2dbpro|A0A8C4J3Z9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Dromaius novaehollandiae GN=BMF (length=209 residues).
MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSQSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHVQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQRVLSSGAVIDQQIKAAS
>gnl|bcl2dbpro|A0A8C4J3Z9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Dromaius novaehollandiae GN=BMF (length=201 residues).
MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSQSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHVQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQSHRKEGLFL
>gnl|bcl2dbpro|A0A8C4J3Z9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Dromaius novaehollandiae GN=BMF (length=198 residues).
MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSQSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHVQR
GHCLFNPGNCVKVWGSSAGGQRNGLYVCESPSRSSDER
© 1998-2022Legal notice