Dataset for protein Bmf of organism Dromaius novaehollandiae

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4J3Z9_BMF-02      MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C4J3Z9_BMF-04      MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C4J3Z9_BMF-01      MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C4J3Z9_BMF-03      MDHPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                       **************************************************

A0A8C4J3Z9_BMF-02      LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSQSSSSQDVMLPCGVTEEP
A0A8C4J3Z9_BMF-04      LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSQSSSSQDVMLPCGVTEEP
A0A8C4J3Z9_BMF-01      LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSQSSSSQDVMLPCGVTEEP
A0A8C4J3Z9_BMF-03      LLGRFQLFPLTHCCGPGSRHPEQQDKATQTLSQSSSSQDVMLPCGVTEEP
                       **************************************************

A0A8C4J3Z9_BMF-02      RRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C4J3Z9_BMF-04      RRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C4J3Z9_BMF-01      RRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C4J3Z9_BMF-03      RRLFYGNAGYRLHVPSVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
                       **************************************************

A0A8C4J3Z9_BMF-02      DQFHRLHVQRGHCLFNPGNCVKVWGSSAGGQRNGLYVCESPSRSSDER--
A0A8C4J3Z9_BMF-04      DQFHRLHVQR-----HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQRVL
A0A8C4J3Z9_BMF-01      DQFHRLHVQR-----HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQR--
A0A8C4J3Z9_BMF-03      DQFHRLHVQR-----HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQSHR
                       **********     :  *  :** .     .*     *:  . :.:   

A0A8C4J3Z9_BMF-02      --------------
A0A8C4J3Z9_BMF-04      SSGAVIDQQIKAAS
A0A8C4J3Z9_BMF-01      --------------
A0A8C4J3Z9_BMF-03      KEGLFL--------
                                     

© 1998-2022Legal notice