Dataset for protein Bmf of organism Dicentrarchus labrax

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C4DD37_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Dicentrarchus labrax GN=BMF (length=207 residues).
MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTPGPALAPYNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QESEGEHNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALLSLLFDRGFIAGRGGA
GRREDSPDVDQLVPLISSHTAVPAAATSSQLSVSLHADWLMRLPRGL
>gnl|bcl2dbpro|A0A8C4DD37_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Dicentrarchus labrax GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTPGPALAPYNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QESEGEHNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALLSLLFDRGFIAGRGGA
GRR
© 1998-2023Legal notice