Dataset for protein Bmf of organism Dicentrarchus labrax

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4DD37_BMF-02      MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTPGPALAPYNGMLPCGVAE
A0A8C4DD37_BMF-01      MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTPGPALAPYNGMLPCGVAE
                       **************************************************

A0A8C4DD37_BMF-02      EPRPLFYGNAGFRLHFPAHFELVGDQEARRQESEGEHNGMEQLPRQQPVA
A0A8C4DD37_BMF-01      EPRPLFYGNAGFRLHFPAHFELVGDQEARRQESEGEHNGMEQLPRQQPVA
                       **************************************************

A0A8C4DD37_BMF-02      RSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALLSLLFD
A0A8C4DD37_BMF-01      RSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALLSLLFD
                       **************************************************

A0A8C4DD37_BMF-02      RGFIAGRGGAGRREDSPDVDQLVPLISSHTAVPAAATSSQLSVSLHADWL
A0A8C4DD37_BMF-01      RGFIAGRGGAGRR-------------------------------------
                       *************                                     

A0A8C4DD37_BMF-02      MRLPRGL
A0A8C4DD37_BMF-01      -------
                              

© 1998-2023Legal notice