Dataset for protein classical BH3-containing proteins of organism Denticeps clupeoides

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C4BKB8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Denticeps clupeoides GN=BAD (length=146 residues).
MAHMFISDSGSDSDVGDTKRPDASRGSRSSEVPRKRQRVYSENNAPCKSEADFQEFGSTEDELLAADSGPFRSRSHSAPP
ALWAARKYGQQLRRMSDEFDMKRVLSAGTAKQMRTSSSWLGILWSHKESEGEANSGLKATGARTAK
>gnl|bcl2dbpro|A0A8C4C2E0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Denticeps clupeoides GN=BMF (length=211 residues).
MEDEDEDVFSGHPHLWHTHFREIKYKDRGTQTPGPALSLGNGMLPFGLAEEPRRLFHGNAAFRLHFPAHFERVGEAMPED
QQGQADRHHQWPSVEAQIGQKLQMIGDQFHQEHVQQHHRNQRWRRQPFLWRLAFALYTLIFERDAVGVQGRGLEQRAGGV
RGRPVVSTVSYPGFTCRTTFLAKTTAAGPMSTTDRRCGFHHISAGSTNKGL
>gnl|bcl2dbpro|A0A8C4C2E0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Denticeps clupeoides GN=BMF (length=171 residues).
MEGVFMRQPVYVDPLMEDEDEDVFSGHPHLWHTHFREIKYKDRGTQTPGPALSLGNGMLPFGLAEEPRRLFHGNAAFRLH
FPAHFERVGEAMPEDQQGQADRHHQWPSVEAQIGQKLQMIGDQFHQEHVQQHHRNQRWRRQPFLWRLAFALYTLIFERDA
VGVQGRGLEQR
>gnl|bcl2dbpro|A0A8C4CCV8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Denticeps clupeoides GN=PMAIP1 (length=50 residues).
RNLQQRNHHRQQPGVLECAVQLREIGDFINWRYKVLDLLLRTYSKSTEIK
© 1998-2022Legal notice