Dataset for protein classical BH3-containing proteins of organism Denticeps clupeoides

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4CCV8_PMAIP1-      -----------------------------------RNLQQRNHHRQQPGV
A0A8C4C2E0_BMF-01       ---------------MEDEDEDVFSGHPHLWHTHFREIKYKDRGTQTPGP
A0A8C4BKB8_BAD-01       MAHMFISDSGSDSDVGDTKRPDASRGSRSSEVPRKRQRVYSENNAPCKSE
A0A8C4C2E0_BMF-02       MEGVFMRQPVYVDPLMEDEDEDVFSGHPHLWHTHFREIKYKDRGTQTPGP
                                                           *:    :.     . 

A0A8C4CCV8_PMAIP1-      L-------------------------------------------------
A0A8C4C2E0_BMF-01       ALSLGNGMLPFGLAEEPRRLFHGNAAFRLHFPAHFERVGEAMPEDQQGQA
A0A8C4BKB8_BAD-01       A-----DFQEFGSTED-----------------------ELLAADSGPFR
A0A8C4C2E0_BMF-02       ALSLGNGMLPFGLAEEPRRLFHGNAAFRLHFPAHFERVGEAMPEDQQGQA
                                                                          

A0A8C4CCV8_PMAIP1-      --------------ECAVQLREIGD---------------------FINW
A0A8C4C2E0_BMF-01       DRHHQWPS---VEAQIGQKLQMIGDQFHQEHVQQHHRNQRWRRQPFLWRL
A0A8C4BKB8_BAD-01       SRSHSAPPALWAARKYGQQLRRMSDEFDMKRVLSAGTAKQMRTSSSWLGI
A0A8C4C2E0_BMF-02       DRHHQWPS---VEAQIGQKLQMIGDQFHQEHVQQHHRNQRWRRQPFLWRL
                                      : . :*. :.*                         

A0A8C4CCV8_PMAIP1-      RYKVLDLLLRTYSKSTEIK-------------------------------
A0A8C4C2E0_BMF-01       AFALYTLIFERDAVGVQGRGLEQRAGGVRGRPVVSTVSYPGFTCRTTFLA
A0A8C4BKB8_BAD-01       LWS------HKESEGEANSGLKATGARTAK--------------------
A0A8C4C2E0_BMF-02       AFALYTLIFERDAVGVQGRGLEQR--------------------------
                         :          : .                                   

A0A8C4CCV8_PMAIP1-      -----------------------------
A0A8C4C2E0_BMF-01       KTTAAGPMSTTDRRCGFHHISAGSTNKGL
A0A8C4BKB8_BAD-01       -----------------------------
A0A8C4C2E0_BMF-02       -----------------------------
                                                     

© 1998-2022Legal notice