Dataset for protein Bim of organism Cyprinus carpio

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C1RI29_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio GN=BCL2L11 (length=181 residues).
DSDTAREQTLANGPASRGGGESAGGGAVLRTEHFDFPQPSEGDPLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSV
PSSPLMPNISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAVQLHAPNEH
AIIIWMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A8C1RI29_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cyprinus carpio GN=BCL2L11 (length=181 residues).
MSDTSREQTLANGPASRGGGESAGGGAVLRTEHFDFPQPSEGDPLRGGISMSNSHQSRSPMSRTFSRSSSGYFSVDSDSV
PSSPLMPNISEAQDDQNDEVWFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAVQLHAPNEH
AIIIWMNDLIGRVVQFFLRRR
© 1998-2022Legal notice