Dataset for protein Bim of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1RI29_BCL2L11      DSDTAREQTLANGPASRGGGESAGGGAVLRTEHFDFPQPSEGDPLRGGIS
A0A8C1RI29_BCL2L11      MSDTSREQTLANGPASRGGGESAGGGAVLRTEHFDFPQPSEGDPLRGGIS
                         ***:*********************************************

A0A8C1RI29_BCL2L11      MSNSHQSRSPMSRTFSRSSSGYFSVDSDSVPSSPLMPNISEAQDDQNDEV
A0A8C1RI29_BCL2L11      MSNSHQSRSPMSRTFSRSSSGYFSVDSDSVPSSPLMPNISEAQDDQNDEV
                        **************************************************

A0A8C1RI29_BCL2L11      WFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNN
A0A8C1RI29_BCL2L11      WFDEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNN
                        **************************************************

A0A8C1RI29_BCL2L11      AVQLHAPNEHAIIIWMNDLIGRVVQFFLRRR
A0A8C1RI29_BCL2L11      AVQLHAPNEHAIIIWMNDLIGRVVQFFLRRR
                        *******************************

© 1998-2022Legal notice