Dataset for protein Bad of organism Cyprinus carpio

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C1K489_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=169 residues).
MCINENAINLVFLLTCSLTMAQMFSISDNESETSEDREESGQTKNNSGSPQRKQHVAVPDRLKGEQLGRHRNLSMNEEDL
LETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKE
SDAESRPAE
>gnl|bcl2dbpro|A0A8C1K489_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=214 residues).
MSHRTPSPVASVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTDSKNRLTMAQMFSISDNESETSE
DREESGQTKNNSGSPQRKQHVAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYG
QQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C1K489_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=214 residues).
MNLLFFSLCPAVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTDSKNRLTMAQMFSISDNESETSE
DREESGQTKNNSGSPQRKQHVAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYG
QQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C1NLV0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=147 residues).
MDKTLHDHQDYSNTLNNKKKGREEIINTHGQHQDQTLPNISPQGRVRLYSESQVYMVSRWQEAEPQDGASVEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRVNSQKQTYRGWFSFLWSPKEEEGRE
© 1998-2023Legal notice