Dataset for protein Bad of organism Cyprinus carpio

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bcl2dbpro|A0A8C1FL78_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=147 residues).
MDNTLHDHQDDPSTWNNKKKGRGETIKNQGQHQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEPQDGALVEENGGLRDA
LSFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|A0A8C1K489_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=214 residues).
MNLLFFSLCPAVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTDSKNRLTMAQMFSISDNESETSE
DREESGQTKNNSGSPQRKQHVAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYG
QQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C1K489_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=169 residues).
MCINENAINLVFLLTCSLTMAQMFSISDNESETSEDREESGQTKNNSGSPQRKQHVAVPDRLKGEQLGRHRNLSMNEEDL
LETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKE
SDAESRPAE
>gnl|bcl2dbpro|A0A8C1K489_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=214 residues).
MSHRTPSPVASVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTDSKNRLTMAQMFSISDNESETSE
DREESGQTKNNSGSPQRKQHVAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYG
QQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C1NLV0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=147 residues).
MDKTLHDHQDYSNTLNNKKKGREEIINTHGQHQDQTLPNISPQGRVRLYSESQVYMVSRWQEAEPQDGASVEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRVNSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|A0A8C1T162_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=259 residues).
MLICVCVCVCVCVCVCVCVCVCVCVCVCVRERERERERERERERERERERERERELEVNCSCAATPHSTGACYDSSRSPN
RASPNTRKTVRRTPTDLRNRLIMAHMFSISDNESESETSDDCEDSGLTKNNSGSLQETNQRLALPQKLKGEQLWRHRNLS
MNDEDLLETGAADEDDLVGGVPFRPRSRSAPPALWAAKKYGQQLRRMSDEFDVLLDKGMKRVKSAGTTRQMRQSTSWFAF
LWSHKESDAESDAESRHTE
>gnl|bcl2dbpro|A0A8C2A067_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=216 residues).
MNLLFFTLCPAVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPVHPEDCTPTDSKNRLTMAQMFSISDNESETET
SEDREESGQTKNNSGSPQRKQHLAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKK
YGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C2A067_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=216 residues).
MSHRTPSPVASVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPVHPEDCTPTDSKNRLTMAQMFSISDNESETET
SEDREESGQTKNNSGSPQRKQHLAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKK
YGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C2EZI8_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=216 residues).
MNLLFFTLCPAVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPDHPEDCTPTDSKNRLTMAQMFSISDNESETET
SEDREESGQTKNNSGSPQRKQHLAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKK
YGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C2EZI8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=216 residues).
MSHRTPSPVASVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPDHPEDCTPTDSKNRLTMAQMFSISDNESETET
SEDREESGQTKNNSGSPQRKQHLAVPDRLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKK
YGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A8C2EZI8_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=171 residues).
MCINENAINLVFLLTCSLTMAQMFSISDNESETETSEDREESGQTKNNSGSPQRKQHLAVPDRLKGEQLGRHRNLSMNEE
DLLETGAADEGDLVGGDPFRRRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSH
KESDAESRPAE
>gnl|bcl2dbpro|A0A8C2JBT6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=147 residues).
MDNTLHDHQDDPSTWNNKKKGRGETIKNQGQHQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEPQDGALVEENGGLRDV
LSFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|A0A8C2Q444_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinus carpio GN=BAD (length=147 residues).
MDKTLHDHQDYSNTLNDKKKGREEIINTHGQHQDQTLPNISPQGRVRLYSESQVYMVSRWQEAEPQDGASVEENGGTGDG
LPFRGRSQSAPAVLWKAKKYGRQLRRMSDEFDTWLDKGEVKRVNSQKQTYRGWFSFLWSPKEEEGRE
© 1998-2022Legal notice