Dataset for protein Bad of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1FL78_BAD-01      --------------------------------------------------
A0A8C2JBT6_BAD-01      --------------------------------------------------
A0A8C1NLV0_BAD-01      --------------------------------------------------
A0A8C2Q444_BAD-01      --------------------------------------------------
A0A8C1K489_BAD-02      -----MCINENAI-------------------------------------
A0A8C2EZI8_BAD-02      -----MCINENAI-------------------------------------
A0A8C1T162_BAD-01      -MLICVCVCVCVCVCVCVCVCVCVCVCVCVRERERERERERERERERERE
A0A8C2A067_BAD-02      MNLLFFTLCPAVC-------------------------------------
A0A8C2EZI8_BAD-03      MNLLFFTLCPAVC-------------------------------------
A0A8C2A067_BAD-01      MSHRTPSPVASVC-------------------------------------
A0A8C2EZI8_BAD-01      MSHRTPSPVASVC-------------------------------------
A0A8C1K489_BAD-03      MNLLFFSLCPAVC-------------------------------------
A0A8C1K489_BAD-01      MSHRTPSPVASVC-------------------------------------
                                                                         

A0A8C1FL78_BAD-01      --------------------------------------------------
A0A8C2JBT6_BAD-01      --------------------------------------------------
A0A8C1NLV0_BAD-01      --------------------------------------------------
A0A8C2Q444_BAD-01      --------------------------------------------------
A0A8C1K489_BAD-02      -----NLVFLLTCS------------------------------------
A0A8C2EZI8_BAD-02      -----NLVFLLTCS------------------------------------
A0A8C1T162_BAD-01      RERERELEVNCSCAATPHSTGACYDSSRSPNRASPNTRKTVRR---TPTD
A0A8C2A067_BAD-02      -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPVHPEDCTPTD
A0A8C2EZI8_BAD-03      -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPDHPEDCTPTD
A0A8C2A067_BAD-01      -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPVHPEDCTPTD
A0A8C2EZI8_BAD-01      -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPDHPEDCTPTD
A0A8C1K489_BAD-03      -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTD
A0A8C1K489_BAD-01      -----EVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEHPEDCTPTD
                                                                         

A0A8C1FL78_BAD-01      MDNTLHDHQDDPSTWNNKKKGRGETIKNQGQHQDQTLPNISPQGRVRLYS
A0A8C2JBT6_BAD-01      MDNTLHDHQDDPSTWNNKKKGRGETIKNQGQHQDQTLPNISPQGRVRLYS
A0A8C1NLV0_BAD-01      MDKTLHDHQDYSNTLNNKKKGREEIINTHGQHQDQTLPNISPQGRVRLYS
A0A8C2Q444_BAD-01      MDKTLHDHQDYSNTLNDKKKGREEIINTHGQHQDQTLPNISPQGRVRLYS
A0A8C1K489_BAD-02      ----LTMAQMFSISDNES--ETSEDREESGQTKNNSGS-PQRKQHVAVPD
A0A8C2EZI8_BAD-02      ----LTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C1T162_BAD-01      LRNRLIMAHMFSISDNESESETSDDCEDSGLTKNNSGSLQETNQRLALPQ
A0A8C2A067_BAD-02      SKNRLTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C2EZI8_BAD-03      SKNRLTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C2A067_BAD-01      SKNRLTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C2EZI8_BAD-01      SKNRLTMAQMFSISDNESETETSEDREESGQTKNNSGS-PQRKQHLAVPD
A0A8C1K489_BAD-03      SKNRLTMAQMFSISDNES--ETSEDREESGQTKNNSGS-PQRKQHVAVPD
A0A8C1K489_BAD-01      SKNRLTMAQMFSISDNES--ETSEDREESGQTKNNSGS-PQRKQHVAVPD
                           *   :  . : *:.     :  :  *  :::: .  . : .: : .

A0A8C1FL78_BAD-01      ESQVYTVSRWQEAEPQDGALVE----ENGGLRDALSFRGRSQSAPAALWK
A0A8C2JBT6_BAD-01      ESQVYTVSRWQEAEPQDGALVE----ENGGLRDVLSFRGRSQSAPAALWK
A0A8C1NLV0_BAD-01      ESQVYMVSRWQEAEPQDGASVE----ENGGTGDGLPFRGRSQSAPAALWK
A0A8C2Q444_BAD-01      ESQVYMVSRWQEAEPQDGASVE----ENGGTGDGLPFRGRSQSAPAVLWK
A0A8C1K489_BAD-02      RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWA
A0A8C2EZI8_BAD-02      RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWA
A0A8C1T162_BAD-01      KLKGEQLWRHRNLSMNDEDLLETGAADEDDLVGGVPFRPRSRSAPPALWA
A0A8C2A067_BAD-02      RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWA
A0A8C2EZI8_BAD-03      RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWA
A0A8C2A067_BAD-01      RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWA
A0A8C2EZI8_BAD-01      RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWA
A0A8C1K489_BAD-03      RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWA
A0A8C1K489_BAD-01      RLKGEQLGRHRNLSMNEEDLLETGAADEGDLVGGDPFRRRSRSAPPALWA
                         :   : *..: . ::   :*    ::..  .  .** **.***..** 

A0A8C1FL78_BAD-01      AKKYGRQLRRMSDEFDTWLDKGEVKRANS-----QKQTYRGWFSFLWSPK
A0A8C2JBT6_BAD-01      AKKYGRQLRRMSDEFDTWLDKGEVKRANS-----QKQTYRGWFSFLWSPK
A0A8C1NLV0_BAD-01      AKKYGRQLRRMSDEFDTWLDKGEVKRVNS-----QKQTYRGWFSFLWSPK
A0A8C2Q444_BAD-01      AKKYGRQLRRMSDEFDTWLDKGEVKRVNS-----QKQTYRGWFSFLWSPK
A0A8C1K489_BAD-02      AKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPSWLAFLWSHK
A0A8C2EZI8_BAD-02      AKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPSWLAFLWSHK
A0A8C1T162_BAD-01      AKKYGQQLRRMSDEFDVLLDKG-MKRVKSAGTTRQMRQSTSWFAFLWSHK
A0A8C2A067_BAD-02      AKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPSWLAFLWSHK
A0A8C2EZI8_BAD-03      AKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPSWLAFLWSHK
A0A8C2A067_BAD-01      AKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPSWLAFLWSHK
A0A8C2EZI8_BAD-01      AKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPSWLAFLWSHK
A0A8C1K489_BAD-03      AKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPSWLAFLWSHK
A0A8C1K489_BAD-01      AKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPSWLAFLWSHK
                       *****.**********  **** :**.:*     * .   .*::**** *

A0A8C1FL78_BAD-01      ----EEEGRE----
A0A8C2JBT6_BAD-01      ----EEEGRE----
A0A8C1NLV0_BAD-01      ----EEEGRE----
A0A8C2Q444_BAD-01      ----EEEGRE----
A0A8C1K489_BAD-02      ----ESDAESRPAE
A0A8C2EZI8_BAD-02      ----ESDAESRPAE
A0A8C1T162_BAD-01      ESDAESDAESRHTE
A0A8C2A067_BAD-02      ----ESDAESRPAE
A0A8C2EZI8_BAD-03      ----ESDAESRPAE
A0A8C2A067_BAD-01      ----ESDAESRPAE
A0A8C2EZI8_BAD-01      ----ESDAESRPAE
A0A8C1K489_BAD-03      ----ESDAESRPAE
A0A8C1K489_BAD-01      ----ESDAESRPAE
                           *.:. .    

© 1998-2022Legal notice