Dataset for protein Bad of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1K489_BAD-01      MSHRTPSPVASVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEH
A0A8C1K489_BAD-03      MNLLFFSLCPAVCEVEVICCCASTRHSTGACQDSSRNPNRASPKHRDPEH
A0A8C1K489_BAD-02      -----MCINENAINLVFLLTCS----------------------------
A0A8C1NLV0_BAD-01      --------------------------------------------------
                                                                         

A0A8C1K489_BAD-01      PEDCTPTDSKNRLTMAQMFSISDNESETSEDREESGQTKNNSGSPQRKQ-
A0A8C1K489_BAD-03      PEDCTPTDSKNRLTMAQMFSISDNESETSEDREESGQTKNNSGSPQRKQ-
A0A8C1K489_BAD-02      ------------LTMAQMFSISDNESETSEDREESGQTKNNSGSPQRKQ-
A0A8C1NLV0_BAD-01      -------------MDKTLHDHQDYSNTLNNKKKGREEIINTHGQHQDQTL
                                        :.. .* ..  .:..:   :  *. *. * :  

A0A8C1K489_BAD-01      -HVAVPDRLKGEQLGRHRNLSMNEEDLLETGAA--DEGDLVGGDPFRRRS
A0A8C1K489_BAD-03      -HVAVPDRLKGEQLGRHRNLSMNEEDLLETGAA--DEGDLVGGDPFRRRS
A0A8C1K489_BAD-02      -HVAVPDRLKGEQLGRHRNLSMNEEDLLETGAA--DEGDLVGGDPFRRRS
A0A8C1NLV0_BAD-01      PNISPQGRVRLYSESQVYMVSRWQEAEPQDGASVEENGGTGDGLPFRGRS
                        :::  .*:.  . ..   :* .:*   : **:  ::*.  .* *** **

A0A8C1K489_BAD-01      RSAPPALWAAKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPS
A0A8C1K489_BAD-03      RSAPPALWAAKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPS
A0A8C1K489_BAD-02      RSAPPALWAAKKYGQQLRRMSDEFDILLDKG-MKRVKSAGTTRQMRQSPS
A0A8C1NLV0_BAD-01      QSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRVNS-----QKQTYRG
                       .***.*** *****.**********  **** :***:*     * .   .

A0A8C1K489_BAD-01      WLAFLWSHKESDAESRPAE
A0A8C1K489_BAD-03      WLAFLWSHKESDAESRPAE
A0A8C1K489_BAD-02      WLAFLWSHKESDAESRPAE
A0A8C1NLV0_BAD-01      WFSFLWSPKEEEGRE----
                       *::**** **.:. .    

© 1998-2023Legal notice