Dataset for protein classical BH3-containing proteins of organism Crocodylus porosus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A7M4F197_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Crocodylus porosus GN=BCL2L11 (length=303 residues).
RSGRSPRRPGPAQTCCAQHIRENNGLGRGRGRAAPPRRRPLLLAGCGAGTARTRRSLALPVPTQQVSGRAGRARSGAAWL
ASFTSKCNGFCRRPADSRSAPVGTAGGFWSVEKGSALLSYFFVCLFVCLFVRSSCGRCFASSHFPDLILSDGACFSELGD
GAVWLQSPDVVSLWSRESLLAMLSLSLQGKKDQMAKQPSDLNSKCGSEDRQLQPRERPSQPQPVRPGAPTSIQTQYQASR
WQYRSIPEDMQPEIWIAQELRRIGDEFNASYCPRRGFWDNQGVNHQIILRLLHYIIRLIWRRQ
>gnl|bcl2dbpro|A0A7M4F197_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Crocodylus porosus GN=BCL2L11 (length=241 residues).
MGWDGAAAGRLLLAAAPSCSPAAGRAQRGPAALSPSQSQHSKFRAEPGGLGAELLGSQVSLQNVMAFVGGRLTPGALRSG
PLGVFGLWKKAGKKDQMAKQPSDLNSKCGSEDRQLQPRERPSQPQPVRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPC
QAFNHYLSAMGKQDHASRWQYRSIPEDMQPEIWIAQELRRIGDEFNASYCPRRGFWDNQGVNHQIILRLLHYIIRLIWRR
Q
>gnl|bcl2dbpro|A0A7M4FB17_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Crocodylus porosus GN=PMAIP1 (length=55 residues).
QSGRDSDTSASPAPAMLPEREAVRECALQLRRIGDQCHLHQKILGLIAKLFRPGT
>gnl|bcl2dbpro|A0A7M4FPU2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Crocodylus porosus GN=BMF (length=193 residues).
MDPSSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTSTGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHTEQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNVGYRLRVPPVGFALSPHLQEEHQEGHQEVRAEVQIARKLQCIADQFHRLHVQR
HQQNRNQVWWQILLFLHNLALNVEANRNQAGQR
© 1998-2021Legal notice