Dataset for protein classical BH3-containing proteins of organism Crocodylus porosus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A7M4FPU2_BMF-01       ---------MDPSSYLEEDYSSLDGLDDDV--------------------
A0A7M4F197_BCL2L11      RSGRSPRRPGPAQTCCAQHIRENNGLGRGRGRAAPPRRRPLLLAGCGAGT
A0A7M4F197_BCL2L11      --------------------MGWDGAAAGR----------LLLAAA----
                                                                          

A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A7M4FPU2_BMF-01       --------------------------------FHSDDFGLAGQP------
A0A7M4F197_BCL2L11      ARTRRSLALPVPTQQVSGRAGRARSGAAWLASFTSKCNGFCRRPADSRSA
A0A7M4F197_BCL2L11      -------------PSCSPAAGRAQRGPAALSPSQSQHSKFRAEP------
                                                                          

A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A7M4FPU2_BMF-01       --------------------------------------------------
A0A7M4F197_BCL2L11      PVGTAGGFWSVEKGSALLSYFFVCLFVCLFVRSSCGRCFASSHFPDLILS
A0A7M4F197_BCL2L11      -----GGL-----GAELLGSQVSLQNVMAFVG------------------
                                                                          

A0A7M4FB17_PMAIP1-      ------------------------------------QSGRDSDTSASPAP
A0A7M4FPU2_BMF-01       -----GEMTSTGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHTEQQDKAT
A0A7M4F197_BCL2L11      DGACFSELGDGAVWLQSPDVVSLWSRESLLAMLSLSLQGKK--DQMAKQP
A0A7M4F197_BCL2L11      -----GRLTPGALRSGPLGVFGLWKKA-----------GKK--DQMAKQP
                                                              *     .    .

A0A7M4FB17_PMAIP1-      AMLPEREAVRECAL------------------------------------
A0A7M4FPU2_BMF-01       QTLNPSSSSQDVML-PCGVTEEPQRLFYGNVGYRLRVPPVGFALSPHLQE
A0A7M4F197_BCL2L11      SDLNSKCGSEDRQLQPRERPSQPQ--------------PVRPGAPTSIQT
A0A7M4F197_BCL2L11      SDLNSKCGSEDRQLQPRERPSQPQ--------------PVRPGAPTSIQT
                          *    .  :  *                                    

A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A7M4FPU2_BMF-01       EHQEGH------------------------------------------QE
A0A7M4F197_BCL2L11      QYQ-----------------------------------ASRWQYRSIPED
A0A7M4F197_BCL2L11      QYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHASRWQYRSIPED
                                                                          

A0A7M4FB17_PMAIP1-      ---------QLRRIGDQCH------------------LHQKILGLIAKLF
A0A7M4FPU2_BMF-01       VRAEVQIARKLQCIADQFHRLHVQR-----HQQNRNQVWWQILLFLHNLA
A0A7M4F197_BCL2L11      MQPEIWIAQELRRIGDEFNASYCPRRGFWDNQGVNHQIILRLLHYIIRLI
A0A7M4F197_BCL2L11      MQPEIWIAQELRRIGDEFNASYCPRRGFWDNQGVNHQIILRLLHYIIRLI
                                 :*. *.*: :                  :  .:*  : .* 

A0A7M4FB17_PMAIP1-      RPGT---------
A0A7M4FPU2_BMF-01       LNVEANRNQAGQR
A0A7M4F197_BCL2L11      WRRQ---------
A0A7M4F197_BCL2L11      WRRQ---------
                                     

© 1998-2021Legal notice