Dataset for protein Bad of organism Cricetulus griseus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C2M216_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cricetulus griseus GN=BAD (length=184 residues).
MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRRPAGRRQGWDLAWEGPPGPCLAPGLLGSIRHQQEQAANSSHHGG
TGAMEIRSRHSSYTAGNEEDDGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
ASWTRIIQSWWDRNLGKGGSAPSQ
>gnl|bcl2dbpro|A0A8C2M216_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cricetulus griseus GN=BAD (length=153 residues).
MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRRPAGRRQGWDLAWEGPPGPCLAPGLLGSIRHQQEQAANSSHHGG
TGAMEIRSRHSSYTAGNEEDDGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKVKLTPFRCVQ
© 1998-2022Legal notice