Dataset for protein Bad of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2M216_BAD-02      MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRRPAGRRQGWDLAWE
A0A8C2M216_BAD-01      MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRRPAGRRQGWDLAWE
                       **************************************************

A0A8C2M216_BAD-02      GPPGPCLAPGLLGSIRHQQEQAANSSHHGGTGAMEIRSRHSSYTAGNEED
A0A8C2M216_BAD-01      GPPGPCLAPGLLGSIRHQQEQAANSSHHGGTGAMEIRSRHSSYTAGNEED
                       **************************************************

A0A8C2M216_BAD-02      DGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKS
A0A8C2M216_BAD-01      DGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKVKLTP--
                       *******************************************    *  

A0A8C2M216_BAD-02      AGTATQMRQSASWTRIIQSWWDRNLGKGGSAPSQ
A0A8C2M216_BAD-01      -------------FRCVQ----------------
                                     * :*                

© 1998-2022Legal notice