Dataset for protein Bmf of organism Coregonus sp balchen

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A6F9B4C5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BMF (length=175 residues).
MFRIHIDLKVLADRRRMDDEEDDVFEPDFHCWRTAFREIKYEDRGTQTPSPVLALPNSMVPCGVAQEPRPLFYGNAGFRL
HFPAQFERVGDQGPQGERGGMERLEQQPQQPARSIEVYIGQKLQLIGDQFLQQHLQLYHRNQRNMRPLWRRLASALLTLL
FEQEAVAGGGRAGWR
>gnl|bcl2dbpro|A0A6F9BGV6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BMF (length=179 residues).
MQGHPLPQLSKQDLADFCRMDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNA
GFRLHFPARFEQVGDQGPQERHQGERGRMERLQQQPQQPAQSMEVCIGQKLQLIGDQFHQEHLQLYHRNQRNMRPLWWRL
ASALLTLLFEQEAIAGRGR
© 1998-2020Legal notice