Dataset for protein Bmf of organism Coregonus sp balchen

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6F9B4C5_BMF-01      ---MFRIHIDLKVLADRRRMDDEEDDVFEPD-FHCWRTAFREIKYEDRGT
A0A6F9BGV6_BMF-01      MQGHPLPQLSKQDLADFCRMDDEEDDVFVPDSSHCWRTAFREIKYEDRGT
                              ::. : ***  ********** **  *****************

A0A6F9B4C5_BMF-01      QTPSPVLALPNSMVPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGP--
A0A6F9BGV6_BMF-01      QTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFPARFEQVGDQGPQE
                       *****.*****.*:************************.**.******  

A0A6F9B4C5_BMF-01      --QGERGGMERLEQQPQQPARSIEVYIGQKLQLIGDQFLQQHLQLYHRNQ
A0A6F9BGV6_BMF-01      RHQGERGRMERLQQQPQQPAQSMEVCIGQKLQLIGDQFHQEHLQLYHRNQ
                         ***** ****:*******.*:** ************ *:*********

A0A6F9B4C5_BMF-01      RNMRPLWRRLASALLTLLFEQEAVAGGGRAGWR
A0A6F9BGV6_BMF-01      RNMRPLWWRLASALLTLLFEQEAIAGRGR----
                       *******.***************:** **    

© 1998-2020Legal notice