Dataset for protein Bad of organism Coregonus sp balchen

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A6F9BAV3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BAD (length=116 residues).
MSTRPRPGGRVRLYSESQVCSQVGKREDTEFQDVMTPTEEGGGDGASFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWL
DKGEPKRGISPGGCKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A6F9CA11_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BAD (length=142 residues).
MAQMFTISDSESEPSEDVGETETDQSAAGKGMTGGPLGHALTAQELQGSGPGVDGVPTDGASFRVRSQSAPPALWAAKKY
GRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHQETETEHTSTIPPRSSE
>gnl|bcl2dbpro|A0A6F9CQZ0_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BAD (length=166 residues).
MFTISDCKSEPSEVGETEKDKSAAGQGMTGGPLGHTLTVPEMRLAGEGRLRLNSESQAFSTSRGKRNGELQGRGPGVDGI
PTDGAPFRVRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMKQLKSVGAAKQMTQSPSWWAYLFSHQETETEHSPNL
TAPEPR
© 1998-2020Legal notice