Dataset for protein Bad of organism Coregonus sp balchen

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6F9BAV3_BAD-01      -------MSTRPRPG-----------------------------------
A0A6F9CA11_BAD-02      MAQMFTISDSESEPSEDVGETETDQSAAGKGMTGGPLGHALTAQ------
A0A6F9CQZ0_BAD-02      ---MFTISDCKSEPSE-VGETEKDKSAAGQGMTGGPLGHTLTVPEMRLAG
                               .  . *.                                   

A0A6F9BAV3_BAD-01      -GRVRLYSESQVCSQVGKREDTEFQDVMTPTEEGGGDGASFRGRSQSAPP
A0A6F9CA11_BAD-02      ----------------------ELQGSGPGVDGVPTDGASFRVRSQSAPP
A0A6F9CQZ0_BAD-02      EGRLRLNSESQAFSTSRGKRNGELQGRGPGVDGIPTDGAPFRVRSQSAPP
                                             *:*.  . .:    ***.** *******

A0A6F9BAV3_BAD-01      ALWAAKKYGCQLRRMSDEFDTWLDKGEPKRGISPGGCKQKV-SRGWFSFL
A0A6F9CA11_BAD-02      ALWAAKKYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYL
A0A6F9CQZ0_BAD-02      ALWAAKRYGRQLRRMSDEFDTWLDKGEMKQLKSVGAAKQMTQSPSWWAYL
                       ******.** ***************** ..  * *..** . * .*:::*

A0A6F9BAV3_BAD-01      WSPKEAEGRE----------
A0A6F9CA11_BAD-02      FSHQETETEHTSTIPPRSSE
A0A6F9CQZ0_BAD-02      FSHQETETEHSPNLTAPEPR
                       :* :*:*             

© 1998-2020Legal notice