Dataset for protein classical BH3-containing proteins of organism Chelydra serpentina

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C3RPK7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Chelydra serpentina GN=PMAIP1 (length=58 residues).
SVDKKVYGIHKADDWFSFVFTAQEAVTQCSLQLRKIGDICNLQQKILNVITKLFCPGT
>gnl|bcl2dbpro|A0A8C3RZA1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Chelydra serpentina GN=BCL2L11 (length=196 residues).
MAKQPSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHTGEGDFAQQPSGSSSPSSPQGPFAPPSSPSPFA
TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESPSIREDMQPEIWIAQEL
RRIGDEFNASYCPRRVTLFYFIFLIFLKIVWGRGGV
>gnl|bcl2dbpro|A0A8C3RZA1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Chelydra serpentina GN=BCL2L11 (length=133 residues).
MAKQPSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWES
PSIREDMQPEIWIAQELRRIGDEFNASYCPRRVTLFYFIFLIFLKIVWGRGGV
>gnl|bcl2dbpro|A0A8C3S2L3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chelydra serpentina GN=BAD (length=154 residues).
MFRIQEFPDEVFPGRGKESPAPPESQRGHTPGSKQPGTPTAEVRSRIGSDPPSLEPEVQDEPGGAFRARSRSAPPILWAA
MRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHWGNSWKETLQAWLGHRPARDAPAGAPSDCSLPAGGMGPAP
>gnl|bcl2dbpro|A0A8C3XI05_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Chelydra serpentina GN=BMF (length=192 residues).
MDPPSYLEEDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREARAEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFLHNLALNVEANRNHIGQR
© 1998-2022Legal notice