Dataset for protein classical BH3-containing proteins of organism Chelydra serpentina

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3RPK7_PMAIP1-      ---------------------------------------SVDKKVY----
A0A8C3RZA1_BCL2L11      ---MAKQPSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNH
A0A8C3XI05_BMF-01       -----------------------------------MDPPSYLEEDYSSLD
A0A8C3RZA1_BCL2L11      ---MAKQPSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQY----
A0A8C3S2L3_BAD-01       MFRIQEFPDEVFPGRGKESPAPPESQRGHTPGSKQPGTPTAEVRSR----
                                                               :          

A0A8C3RPK7_PMAIP1-      --------------------------------------------------
A0A8C3RZA1_BCL2L11      TGEGDFAQQP---SGSSSPSSPQGPFAPPSSPSPFATRSPLFIFVRRSSL
A0A8C3XI05_BMF-01       GLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGP
A0A8C3RZA1_BCL2L11      --------------------------------------------------
A0A8C3S2L3_BAD-01       --------------------------------------------------
                                                                          

A0A8C3RPK7_PMAIP1-      -----------GIHKADDWFSFVFTAQEAVTQC-----------------
A0A8C3RZA1_BCL2L11      LSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC----QAFNHYLSAMASR
A0A8C3XI05_BMF-01       GIRHAE-----QQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYGNAGYR
A0A8C3RZA1_BCL2L11      ------------QDRSPAPMSCDKSTQTPSPPC----QAFNHYLSAMASR
A0A8C3S2L3_BAD-01       ------------IGSDPPSL----EPEVQDEPG----GAFR---------
                                           :     .:                       

A0A8C3RPK7_PMAIP1-      -----------------------------------SLQLRKIGDICNLQQ
A0A8C3RZA1_BCL2L11      WESPSIREDMQP---------------EIWIA----QELRRIGDEFNASY
A0A8C3XI05_BMF-01       LHVPPVGFALNPHLQEEPREGQREARAEVQIA----RKLQCIADQFHRLH
A0A8C3RZA1_BCL2L11      WESPSIREDMQP---------------EIWIA----QELRRIGDEFNASY
A0A8C3S2L3_BAD-01       ----ARSRSAPP---------------ILWAAMRYGRELRRMSDEFDVAL
                                                             :*. :.*      

A0A8C3RPK7_PMAIP1-      -----------------KILNVITKLFC----------------------
A0A8C3RZA1_BCL2L11      ----CPRRV--------TLFYFIFLIFLKIVWGR----------------
A0A8C3XI05_BMF-01       ----IQRHQQNRNQVWWQILLFLHNLALNVEANR----------------
A0A8C3RZA1_BCL2L11      ----CPRRV--------TLFYFIFLIFLKIVWGR----------------
A0A8C3S2L3_BAD-01       QVLPRPKSA--------G-------TTSQLHWGNSWKETLQAWLGHRPAR
                                                                          

A0A8C3RPK7_PMAIP1-      --------------PGT----
A0A8C3RZA1_BCL2L11      --------------GGV----
A0A8C3XI05_BMF-01       --------------NHIGQR-
A0A8C3RZA1_BCL2L11      --------------GGV----
A0A8C3S2L3_BAD-01       DAPAGAPSDCSLPAGGMGPAP
                                             

© 1998-2022Legal notice