Dataset for protein classical BH3-containing proteins of organism Chelonoidis abingdonii

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C0GH19_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Chelonoidis abingdonii GN=BMF (length=192 residues).
MDPPSYLEDDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFIHNLALNVEANRNHVGQR
>gnl|bcl2dbpro|A0A8C0GP31_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Chelonoidis abingdonii GN=PMAIP1 (length=54 residues).
MPGKTLRKGAQQNPAPAAQEAVTQCSLQLRKIGDICNLQQKILNVITKLFCPGT
>gnl|bcl2dbpro|A0A8C0IJG1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chelonoidis abingdonii GN=BAD (length=141 residues).
MFRIQEFPDEVFPGRGKEAPAPPESQRGHTPGSKQPDTPIAEVRNRIGSDTPSLEPEVQDEPGGAFRARSRSAPPILWAA
MRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHQGNSWKETLQAWLGHRPARDALPRSSK
>gnl|bcl2dbpro|A0A8C0QRC8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Chelonoidis abingdonii GN=BCL2L11 (length=183 residues).
MAKQPSDLNSECNREGGQFQSTERPSQPQHLRPGAPTSIQTQYQGNHSGEGDFAQQPSGSSSPSSPQGPFAPPSSPSPFA
TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESSSIREDMQPEIWIAQEL
RRIGDEFNASYCPRRVTLFYFIF
© 1998-2022Legal notice