Dataset for protein classical BH3-containing proteins of organism Chelonoidis abingdonii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0GP31_PMAIP1-      --------------------------------------------------
A0A8C0IJG1_BAD-01       MFRIQEFPDEVFPGRGKEAPAPPESQRGHTPGSKQPDTPIAEVRNRIGSD
A0A8C0GH19_BMF-01       -----------------------------------MDPPSYLEDDYSSLD
A0A8C0QRC8_BCL2L11      ---MAKQPSDLNSECNREGGQFQSTERPSQPQHLRPGAPTSIQTQYQGNH
                                                                          

A0A8C0GP31_PMAIP1-      --------------------MPGKTLRKGAQQNP----------------
A0A8C0IJG1_BAD-01       TPSLEPEVQD----------EPGGAFRARSRSAP-----PILWAAMRYGR
A0A8C0GH19_BMF-01       GLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGP
A0A8C0QRC8_BCL2L11      SGEGDFAQQP---SGSSSPSSPQGPFAPPSSPSPFATRSPLFIFVRRSSL
                                             *   :                        

A0A8C0GP31_PMAIP1-      ----------------------APAAQEAVTQC----------------S
A0A8C0IJG1_BAD-01       ELRRMSDEFDVALQVLPRPKSAGTTSQ--LHQGNSWKETLQAWLGHRPAR
A0A8C0GH19_BMF-01       GIRHAE-----QQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYGNAGYR
A0A8C0QRC8_BCL2L11      LSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC----QAFNHYLSAMASR
                                                ::*                       

A0A8C0GP31_PMAIP1-      LQLRKIGD----------------------ICNLQQKILNVITKLFCPGT
A0A8C0IJG1_BAD-01       DALPRSSK------------------------------------------
A0A8C0GH19_BMF-01       LHVPPVGFALNPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQRH
A0A8C0QRC8_BCL2L11      WESSSIREDMQP---------------EIWIAQELRRIGDEFNASYCPR-
                                                                          

A0A8C0GP31_PMAIP1-      --------------------------------
A0A8C0IJG1_BAD-01       --------------------------------
A0A8C0GH19_BMF-01       QQNRNQVWWQILLFIHNLALNVEANRNHVGQR
A0A8C0QRC8_BCL2L11      ---RVTLFYFIF--------------------
                                                        

© 1998-2022Legal notice