Dataset for protein Bim of organism Catharus ustulatus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C3TPU0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Catharus ustulatus GN=BCL2L11 (length=131 residues).
MAKQPPEVKARRDGEGGRLPAAEGPGPGAPGPFATRSPAPALGCDKATQTPSPPCQALSHCLSAMASRWQSRSPAEEVQP
EIWIAQELRRIGDEFNASYGPRRGRDQAVGNPQVVILRLLRYIIRLIWRLQ
>gnl|bcl2dbpro|A0A8C3TPU0_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Catharus ustulatus GN=BCL2L11 (length=134 residues).
MAKQPPEVKARRDGEGGRLPAAEGPGPGAPGPFATRSPAPALGCDKATQTPSPPCQALSHCLSAMGKLRANGKSSVLCHR
DSWIHPGRLSWEHRAAELFYPHPGLQLSLGNTHGFALHTSSIPVPWQCPAGRVP
>gnl|bcl2dbpro|A0A8C3TPU0_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Catharus ustulatus GN=BCL2L11 (length=183 residues).
MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSAARGPPASPGPFATRSPLFIFVRRSPLLPRSSSG
YFSFDAERSPAPALGCDKATQTPSPPCQALSHCLSAMASRWQSRSPAEEVQPEIWIAQELRRIGDEFNASYGPRRLPHCS
QAWLAVILLFLHLLHFSQMAWHS
>gnl|bcl2dbpro|A0A8C3TPU0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Catharus ustulatus GN=BCL2L11 (length=184 residues).
MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSAARGPPASPGPFATRSPLFIFVRRSPLLPRSSSG
YFSFDAERSPAPALGCDKATQTPSPPCQALSHCLSAMASRWQSRSPAEEVQPEIWIAQELRRIGDEFNASYGPRRGFLDQ
QVGNPQVVILRLLRYIIRLIWRLQ
© 1998-2023Legal notice