Dataset for protein Bim of organism Catharus ustulatus

[Download (right click)] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C3TPU0_BCL2L11-01      MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSAARG
A0A8C3TPU0_BCL2L11-03      MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSAARG
A0A8C3TPU0_BCL2L11-04      MAKQPPEVKARRDGEGGRLPAAEGPGPGA---------------------
A0A8C3TPU0_BCL2L11-02      MAKQPPEVKARRDGEGGRLPAAEGPGPGA---------------------
                           *****************************                     

A0A8C3TPU0_BCL2L11-01      PPASPGPFATRSPLFIFVRRSPLLPRSSSGYFSFDAERSPAPALGCDKAT
A0A8C3TPU0_BCL2L11-03      PPASPGPFATRSPLFIFVRRSPLLPRSSSGYFSFDAERSPAPALGCDKAT
A0A8C3TPU0_BCL2L11-04      ----PGPFATR---------------------------SPAPALGCDKAT
A0A8C3TPU0_BCL2L11-02      ----PGPFATR---------------------------SPAPALGCDKAT
                               *******                           ************

A0A8C3TPU0_BCL2L11-01      QTPSPPCQALSHCLSAMASRWQSRSPAEEVQPEIWIAQELRRIGDEFNA-
A0A8C3TPU0_BCL2L11-03      QTPSPPCQALSHCLSAMASRWQSRSPAEEVQPEIWIAQELRRIGDEFNA-
A0A8C3TPU0_BCL2L11-04      QTPSPPCQALSHCLSAMGKLRANGKSSVLCHRDSWIHPG--RLSWEHRAA
A0A8C3TPU0_BCL2L11-02      QTPSPPCQALSHCLSAMASRWQSRSPAEEVQPEIWIAQELRRIGDEFNA-
                           *****************..   . ..:   : : **     *:. *..* 

A0A8C3TPU0_BCL2L11-01      -SYGPRRGFLD-QQVGNPQVVILRLLRYIIRLIW-----RLQ
A0A8C3TPU0_BCL2L11-03      -SYGPRRLP-HCSQAWLAVILLFLHLLHFSQMAW-----H-S
A0A8C3TPU0_BCL2L11-04      ELFYPHPGL-Q-LSLGNTHGFALHT--SSIPVPWQCPAGRVP
A0A8C3TPU0_BCL2L11-02      -SYGPRRGR-D-QAVGNPQVVILRLLRYIIRLIW-----RLQ
                             : *:    .      .  . :        : *     :  

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice