Dataset for protein Bim of organism Catharus ustulatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3TPU0_BCL2L11      MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSAARG
A0A8C3TPU0_BCL2L11      MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSAARG
A0A8C3TPU0_BCL2L11      MAKQPPEVKARRDGEGGRLPAAEGPGPGA---------------------
A0A8C3TPU0_BCL2L11      MAKQPPEVKARRDGEGGRLPAAEGPGPGA---------------------
                        *****************************                     

A0A8C3TPU0_BCL2L11      PPASPGPFATRSPLFIFVRRSPLLPRSSSGYFSFDAERSPAPALGCDKAT
A0A8C3TPU0_BCL2L11      PPASPGPFATRSPLFIFVRRSPLLPRSSSGYFSFDAERSPAPALGCDKAT
A0A8C3TPU0_BCL2L11      ----PGPFAT---------------------------RSPAPALGCDKAT
A0A8C3TPU0_BCL2L11      ----PGPFAT---------------------------RSPAPALGCDKAT
                            ******                           *************

A0A8C3TPU0_BCL2L11      QTPSPPCQALSHCLSAMASRWQSRSPAEEVQPEIWIAQELRRIGDEFNAS
A0A8C3TPU0_BCL2L11      QTPSPPCQALSHCLSAMASRWQSRSPAEEVQPEIWIAQELRRIGDEFNAS
A0A8C3TPU0_BCL2L11      QTPSPPCQALSHCLSAMASRWQSRSPAEEVQPEIWIAQELRRIGDEFNAS
A0A8C3TPU0_BCL2L11      QTPSPPCQALSHCLSAMGKLRANGKSSVLCHRDSWIHPGRLSWEHRAAEL
                        *****************.. . . ..:   : : **              

A0A8C3TPU0_BCL2L11      YGPRRLPHCSQAWLAVILLFLHLLHFSQMAW-----HS-
A0A8C3TPU0_BCL2L11      YGPRRGFLDQQVGNPQVVILRLLRYIIRLIW-----RLQ
A0A8C3TPU0_BCL2L11      YGPRRG-RDQAVGNPQVVILRLLRYIIRLIW-----RLQ
A0A8C3TPU0_BCL2L11      FYPHPG-LQLSLGNTHGFALHTSS--IPVPWQCPAGRVP
                        : *.          .  . :        : *     .  

© 1998-2023Legal notice