Dataset for protein Bmf of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A452F2E0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Capra hircus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A452F2E0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Capra hircus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A8C2SHH9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Capra hircus GN=BMF (length=226 residues).
MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRMW
WQILLFLHNVALNGDENRNGAGPRASTRSWGPLSNTVEVEAGVSPWNLLRARTSRSFCHQLLKTTR
© 1998-2022Legal notice