Dataset for protein Bmf of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452F2E0_BMF-01      MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLF
A0A452F2E0_BMF-02      MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLF
A0A8C2SHH9_BMF-01      MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLF
                       **************************************************

A0A452F2E0_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A452F2E0_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A8C2SHH9_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
                       **************************************************

A0A452F2E0_BMF-01      GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQ
A0A452F2E0_BMF-02      GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQ
A0A8C2SHH9_BMF-01      GYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQ
                       **************************************************

A0A452F2E0_BMF-01      QHQQNRNRMWWQILLFLHNVALNGDENRNGAGPR----------------
A0A452F2E0_BMF-02      QHQQNRNRMWWQILLFLHNVALNGDENRNGAGPR----------------
A0A8C2SHH9_BMF-01      QHQQNRNRMWWQILLFLHNVALNGDENRNGAGPRASTRSWGPLSNTVEVE
                       **********************************                

A0A452F2E0_BMF-01      --------------------------
A0A452F2E0_BMF-02      --------------------------
A0A8C2SHH9_BMF-01      AGVSPWNLLRARTSRSFCHQLLKTTR
                                                 

© 1998-2022Legal notice