Dataset for protein Bik of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8I3NT74_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Canis lupus familiaris GN=BIK (length=256 residues).
MTGGGGVPAVAGSSPTPSFHIGEMAWTKAPGGRDPLGRRMGPPAWRPWPRSARRRRRRRRARVGDRAGGGEAAGGGPERD
RRFISSRARGGRTQSRPGSSAPDPREEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSPNSNNPDDVAM
RLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSL
LLLLVLLLGWGLRLLQ
>gnl|bcl2dbpro|A0A8P0TQZ3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Canis lupus familiaris GN=BIK (length=233 residues).
MAWTKAPGGRDPLGRRMGPPAWRPWPRSARRRRRRRRARVGDRAGGGEAAGGGPERDRRFISSRARGGRTQSRPGSSAPD
PREEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPG
MAMYSLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
© 1998-2023Legal notice