Dataset for protein Bik of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8I3NT74_BIK-01      MTGGGGVPAVAGSSPTPSFHIGEMAWTKAPGGRDPLGRRMGPPAWRPWPR
A0A8P0TQZ3_BIK-01      -----------------------MAWTKAPGGRDPLGRRMGPPAWRPWPR
                                              ***************************

A0A8I3NT74_BIK-01      SARRRRRRRRARVGDRAGGGEAAGGGPERDRRFISSRARGGRTQSRPGSS
A0A8P0TQZ3_BIK-01      SARRRRRRRRARVGDRAGGGEAAGGGPERDRRFISSRARGGRTQSRPGSS
                       **************************************************

A0A8I3NT74_BIK-01      APDPREEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSP
A0A8P0TQZ3_BIK-01      APDPREEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSP
                       **************************************************

A0A8I3NT74_BIK-01      NSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRG
A0A8P0TQZ3_BIK-01      NSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRG
                       **************************************************

A0A8I3NT74_BIK-01      VLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGW
A0A8P0TQZ3_BIK-01      VLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGW
                       **************************************************

A0A8I3NT74_BIK-01      GLRLLQ
A0A8P0TQZ3_BIK-01      GLRLLQ
                       ******

© 1998-2023Legal notice