Dataset for protein Puma of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|J9NTK9_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Canis lupus familiaris GN=BBC3 (length=268 residues).
MPCVTPRLGPRERHGPSTPGGQLPGARRGPGPRRSAPVSPQPPGALGRVLRPLRARPARRPCCPCPAARCLPLRPHRPAR
RHRRPGGPPLAWGSPQPAPRPAPRRSSALTVAGGTAPGIAGAQRPGGPGGRSHPSSPGSPGGGGAVGPGDRGPAAADGGR
PQRAVRAAGECWGRGRRQVGLPAREGAAGGPARCAAAAARRGGVALGTGRWDGRRAHGPAEGPAPRLARPGQGPGPPRAP
RRVRGPRPRGLRAALGGAAHISRAIYSR
>gnl|bcl2dbpro|J9NTK9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Canis lupus familiaris GN=BBC3 (length=293 residues).
MQGLPGHVPVRCSGFPSGPVGPPSDLCQARLDVPAPECVPISGPVTRNLLQAPGSAMARARQEGSSPEPVEGLARDGPRP
FPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHL
ESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRVSVGGGVDGRWDFPPGRGLRAAPPDVRQL
LPGAAGSRWGQAGGMGDGPTDLPKGPRRGWHDPGKGRDRLERRGASVALGRGD
>gnl|bcl2dbpro|J9NTK9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Canis lupus familiaris GN=BBC3 (length=240 residues).
MPCVTPRLGPRERHGPSTPGGQLPGARRGPGPRRSAPVSPQPPGALGRVLRPLRARPARRPCCPCPAARCLPLRPHRPAR
RHRRPGGPPLAWGSPQPAPRPAPRRSSALTVAGGTAPGIAGAQRPGGPGGRSHPSSPGSPGGGGAVGPGDRGPAAADGGR
PQRAVRAAETRGAAATPPLTLEGPVQSHHGTPALTQGPWSPGDGAQLGACTRPVDIRDLGGRTLPPPDALASAGDFFCTM
© 1998-2020Legal notice