Dataset for protein Puma of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0MK34_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A8I3MGC5_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
                        **************************************************

A0A8C0MK34_BBC3-01      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPA
A0A8I3MGC5_BBC3-01      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPA
                        **************************************************

A0A8C0MK34_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A8I3MGC5_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
                        **************************************************

A0A8C0MK34_BBC3-01      LYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
A0A8I3MGC5_BBC3-01      LYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
                        *******************************************

© 1998-2023Legal notice